PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20247.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Whirly
Protein Properties Length: 83aa    MW: 9241.55 Da    PI: 8.6149
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20247.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly67.42.6e-21969262
     Whirly  2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatev 62
               vyk+kaa++v +v+ptf++ldsg  +++r G ++l++++a++erkydWek+q+  l +t  
  PK20247.2  9 VYKGKAAFSVTPVLPTFTKLDSGLHVVDRGGCMMLKFTPAIGERKYDWEKRQVSDLYSTCY 69
               8***************************************************999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.2E-22567IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.43E-19564IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.2E-19967IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
XGFSAPYIVY KGKAAFSVTP VLPTFTKLDS GLHVVDRGGC MMLKFTPAIG ERKYDWEKRQ  60
VSDLYSTCYS LIVCCLIAKS DYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_D1e-225601368Single-stranded DNA-binding protein WHY2, mit
4kop_C1e-225601368Single-stranded DNA-binding protein WHY2, mit
4kop_B1e-225601368Single-stranded DNA-binding protein WHY2, mit
4kop_A1e-225601368Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112062.13e-28Protein BEARSKIN1
SwissprotQ8VYF75e-23WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLW9SHN53e-28W9SHN5_9R
STRINGGLYMA19G43880.24e-22(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.13e-24WHIRLY 2